PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna26214.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 304aa    MW: 32635.3 Da    PI: 7.6898
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna26214.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.52e-10654347
                             SS-HHHHHHHHHHHHHTTTT.....-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg.....tWktIartmgkgRtlkqcksrwqky 47
                             +W+ eEd+ + +a++++  +     +W++Ia+ ++ +++ +++k ++q++
  mrna26214.1-v1.0-hybrid  6 AWSREEDKAFENAIALHWIEddeegSWDKIASLVP-TKSMEELKRHYQML 54
                             6****************99999*************.************86 PP

2Myb_DNA-binding38.92e-12135179347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
  mrna26214.1-v1.0-hybrid 135 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 179
                              7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.019159IPR017884SANT domain
SMARTSM007171.7E-6357IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-5555IPR009057Homeodomain-like
PfamPF002493.1E-8654IPR001005SANT/Myb domain
CDDcd001672.80E-10655No hitNo description
SuperFamilySSF466892.48E-9761IPR009057Homeodomain-like
PROSITE profilePS5129417.097128184IPR017930Myb domain
SuperFamilySSF466893.89E-17129185IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-17131182IPR006447Myb domain, plants
SMARTSM007172.3E-10132182IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-11133178IPR009057Homeodomain-like
CDDcd001671.03E-9135180No hitNo description
PfamPF002497.5E-11135179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MSCNAAWSRE EDKAFENAIA LHWIEDDEEG SWDKIASLVP TKSMEELKRH YQMLVDDVGA  60
IESGNIPVPI YGGDEAATTS VSSTARASSS SASDKRLSSS HGNNGGGFSA LGHDSSGHGS  120
KGGSRSEQER KKGIPWTEEE HRLFLLGLDK FGKGDWRSIS RNFVISRTPT QVASHAQKYF  180
IRLNSMNRDR RRSSIHDITS VNNGGDVPNH QVPITGQQSN AYAPGAAAIG PPSVKHRPHQ  240
PHMAGLGMYG APMGHPVSAP PGHMASAVGT PVMLPPGHHP HHAHPPPYVV PVAYPMAHPT  300
MHQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAPTransfer from AT1G49010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285540.0FR828554.1 Rosa hybrid cultivar mRNA for putative MYB transcription factor (myb3 gene), cultivar Yellow Island.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299236.10.0PREDICTED: transcription factor DIVARICATA
TrEMBLF2QKX41e-173F2QKX4_R
STRINGPGSC0003DMT4000143501e-139(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106943340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.19e-73MYB family protein